Antibodies

View as table Download

Goat Polyclonal Antibody against ELMO1

Applications WB
Reactivities Human, Zebrafish, Cow (Expected from sequence similarity: Mouse, Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence PKEPSNYDFVYDCN, from the C Terminus of the protein sequence according to NP_055615.8; NP_569709.1; NP_001034548.1.

Rabbit Polyclonal Anti-ELMO1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ELMO1 antibody: synthetic peptide directed towards the C terminal of human ELMO1. Synthetic peptide located within the following region: TQTPPGMLALDNMLYFAKHHQDAYIRIVLENSSREDKHECPFGRSSIELT