Antibodies

View as table Download

Rabbit Polyclonal Anti-MPG Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human MPG

Rabbit anti-MPG Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human MPG

Rabbit Polyclonal Anti-MPG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MPG Antibody: synthetic peptide directed towards the C terminal of human MPG. Synthetic peptide located within the following region: LEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQA

Goat Polyclonal Antibody against MPG

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SVVDRVAEQDTQA, from the C Terminus of the protein sequence according to NP_002425.2; NP_001015052.1; NP_001015054.1.

Rabbit Polyclonal Anti-MPG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MPG Antibody: synthetic peptide directed towards the middle region of human MPG. Synthetic peptide located within the following region: QRDLAQDEAVWLERGPLEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGS