Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CYP11A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP11A1 antibody: synthetic peptide directed towards the middle region of human CYP11A1. Synthetic peptide located within the following region: LRQKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQW |
Rabbit polyclonal CYP27B1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CYP27B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 482-508 amino acids from the C-terminal region of human CYP27B1. |
Rabbit polyclonal CYP1A2 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CYP1A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 255-282 amino acids from the Central region of human CYP1A2. |
Rabbit polyclonal CYP3A5 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CYP3A5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 476-502 amino acids from the C-terminal region of human CYP3A5. |
Rabbit Polyclonal Anti-CYP11B1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP11B1 antibody: synthetic peptide directed towards the C terminal of human CYP11B1. Synthetic peptide located within the following region: ARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGL |
Rabbit polyclonal CYP2B6 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CYP2B6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 235-263 amino acids from the Central region of human CYP2B6. |
Rabbit polyclonal antibody to Cytochrome P450 4A11 (cytochrome P450, family 4, subfamily A, polypeptide 11)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 48 and 316 of CYP4A11 (Uniprot ID#Q02928) |
Active filters
Reactivities
- Human
Applications
- WB
Isotypes
- IgG
Clonalities
- Polyclonal
Conjugates
- Unconjugated
Families
- P450
Pathways
- Metabolic pathways
Filter by
Category
Target Symbol
- CYTOCHROME P450 2B6 (6)
- CYTOCHROME P450 3A4 (6)
- CYTOCHROME P450 2E1 (5)
- CYP11A1 (4)
- CYP2A7 (4)
- TBXAS1 (4)
- AROMATASE (3)
- CYP11B1 (3)
- CYP21A2 (3)
- CYP27A1 (3)
- CYP3A7 (3)
- CYP8B1 (3)
- CYTOCHROME P450 17A1 (3)
- CYTOCHROME P450 2A6 (3)
- CYTOCHROME P450 2J2 (3)
- CYP2C18 (2)
- CYP2U1 (2)
- CYP4A22 (2)
- CYTOCHROME P450 1A2 (2)
- CYTOCHROME P450 3A5 (2)
- CYTOCHROME P450 4A (2)
- PTGIS (2)
- CYP27B1 (1)
- CYP4F3 (1)
- CYP51A1 (1)
- CYTOCHROME P450 2C9 (1)
- P4HA1 (1)