Rabbit Polyclonal Anti-GP1BA Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GP1BA |
Rabbit Polyclonal Anti-GP1BA Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GP1BA |
Rabbit Polyclonal Anti-GP1BA
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GP1BA antibody: synthetic peptide directed towards the C terminal of human GP1BA. Synthetic peptide located within the following region: RGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYS |
Rabbit Polyclonal Anti-GP1BA
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GP1BA antibody is: synthetic peptide directed towards the middle region of Human GP1BA. Synthetic peptide located within the following region: TPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGS |