Antibodies

View as table Download

Rabbit Polyclonal Anti-TSG101 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TSG101 antibody: synthetic peptide directed towards the C terminal of human TSG101. Synthetic peptide located within the following region: TIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY

Rabbit Polyclonal Anti-TSG101 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TSG101 Antibody is: synthetic peptide directed towards the N-terminal region of Human TSG101. Synthetic peptide located within the following region: YKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYR