MET pTyr1234 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MET pTyr1234 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Mouse monoclonal Akt phospho pT308 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Monkey |
Conjugation | Unconjugated |
Rabbit polyclonal p16-INK4a (Phospho-Ser152) antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p16-INK4a around the phosphorylation site of serine 152 (G-P-SP-D-I). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-FGF2 Antibody
Applications | WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FGF2 |
RAF1 pSer621 mouse monoclonal antibody, clone 6B4, Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ARAF mouse monoclonal antibody, clone OTI2G4 (formerly 2G4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Goat Polyclonal Antibody against FGFR1
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence RCRLRDDVQSIN, from the internal region of the protein sequence according to NP_075598.2; NP_056934.2; NP_075593.1; NP_075594.1; NP_001167534.1; NP_001167535.1; NP_001167538.1. |
Mouse monoclonal AKT1 Antibody(Ascites)
Applications | WB |
Reactivities | Human (Predicted: Mouse, Rat, Bovine) |
Conjugation | Unconjugated |
Goat Anti-cyclin D1 Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence TRFLSRVIKCDPD, from the internal region of the protein sequence according to NP_444284.1 |
Rabbit Polyclonal Anti-PIK3R3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PIK3R3 antibody is: synthetic peptide directed towards the C-terminal region of Human PIK3R3. Synthetic peptide located within the following region: DAVGKKLQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIK |
Rabbit Polyclonal Anti-IGF1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IGF1 antibody: A synthesized peptide derived from human IGF1 |