Rabbit polyclonal anti-FGF2 Antibody
Applications | WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FGF2 |
Rabbit polyclonal anti-FGF2 Antibody
Applications | WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FGF2 |
LIM Kinase 1 (LIMK1) (+LIMK2) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-PIP5K1A Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Pip5k1a antibody is: synthetic peptide directed towards the N-terminal region of Mouse Pip5k1a. Synthetic peptide located within the following region: EGPSASVMPVKKIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLS |
Rabbit Polyclonal Anti-vinculin Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-vinculin Antibody: A synthesized peptide derived from human vinculin |
Goat Polyclonal Antibody against FGFR1
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence RCRLRDDVQSIN, from the internal region of the protein sequence according to NP_075598.2; NP_056934.2; NP_075593.1; NP_075594.1; NP_001167534.1; NP_001167535.1; NP_001167538.1. |
Rabbit Polyclonal Anti-Actin-pan Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Actin-pan Antibody: A synthesized peptide derived from human Actin-pan |