Antibodies

View as table Download

Rabbit polyclonal anti-FGF2 Antibody

Applications WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human FGF2

LIM Kinase 1 (LIMK1) (+LIMK2) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-PIP5K1A Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Pip5k1a antibody is: synthetic peptide directed towards the N-terminal region of Mouse Pip5k1a. Synthetic peptide located within the following region: EGPSASVMPVKKIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLS

Rabbit Polyclonal Anti-vinculin Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-vinculin Antibody: A synthesized peptide derived from human vinculin

Goat Polyclonal Antibody against FGFR1

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Dog, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence RCRLRDDVQSIN, from the internal region of the protein sequence according to NP_075598.2; NP_056934.2; NP_075593.1; NP_075594.1; NP_001167534.1; NP_001167535.1; NP_001167538.1.

Rabbit Polyclonal Anti-Actin-pan Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Actin-pan Antibody: A synthesized peptide derived from human Actin-pan