Antibodies

Jump to Filters
View as table Download
Rab5 (RAB5A) Goat Polyclonal Antibody
AB0009-200

USD 355.00

In Stock

Goat Polyclonal Anti-Rab5a Antibody

Applications IF, IHC, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 115 aa to the C-terminus of mouse Rab5a produced in E. coli.
EGFR Rabbit Polyclonal Antibody
TA312545

USD 380.00

4 Weeks

Rabbit polyclonal EGFR (Ab-1172) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q).
VEGF Receptor 2 (KDR) Rabbit Polyclonal Antibody
TA309974

USD 565.00

2 Weeks

Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G).
Modifications Phospho-specific
VEGF Receptor 2 (KDR) Rabbit Polyclonal Antibody
TA325608

USD 380.00

4 Weeks

Rabbit Polyclonal VEGFR2 (Tyr1214) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human VEGFR2 around the phosphorylation site of Tyrosine 1214
Modifications Phospho-specific
TGF beta Receptor II (TGFBR2) Rabbit Polyclonal Antibody
TA311643

USD 380.00

2 Weeks

Rabbit polyclonal TGFBR2 (Ab-250) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I).
PKC zeta (PRKCZ) Rabbit Polyclonal Antibody
TA312044

USD 380.00

4 Weeks

Rabbit polyclonal PKC zeta (Thr410) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PKC? around the phosphorylation site of threonine 410 (T-S-TP-F-C).
Modifications Phospho-specific
RAB11A Goat Polyclonal Antibody
AB3035-200

USD 330.00

In Stock

Goat Polyclonal Anti-Rab11 Antibody

Applications IHC, WB
Reactivities Canine, Human, Monkey, Rat, Mouse
Conjugation Unconjugated
Immunogen Purified recombinant peptides derived from within residues 110 aa to the C-terminus of mouse Rab11a, Rab11b and Rab11c (Rab25) produced in E. coli.
MDM2 Rabbit Polyclonal Antibody
TA311996

USD 380.00

In Stock

Rabbit polyclonal MDM2 (Ab-166) antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human MDM2 around the phosphorylation site of serine 166 (A-I-SP-E-T).
TRAF6 Rabbit Polyclonal Antibody
TA306124

USD 570.00

5 Days

Rabbit Polyclonal TRAF6 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TRAF6 antibody was raised against a peptide corresponding to 14 amino acids near the C-terminus of human TRAF6.
FGFR4 Rabbit Polyclonal Antibody
TA311938

USD 380.00

4 Weeks

Rabbit polyclonal FGFR4 (Tyr642) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human FGFR4 around the phosphorylation site of tyrosine 642.
Modifications Phospho-specific
PAR6 (PARD6A) Rabbit Polyclonal Antibody
TA323360

USD 380.00

In Stock

Anti-PARD6A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 334-346 amino acids of human par-6 partitioning defective 6 homolog alpha (C. elegans)
TGF beta Receptor II (TGFBR2) Rabbit Polyclonal Antibody
TA347477

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-TGFR2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TGFR2 Antibody: A synthesized peptide derived from human TGFR2
VEGF Receptor 2 (KDR) Rabbit Polyclonal Antibody
TA311979

USD 380.00

4 Weeks

Rabbit polyclonal KDR / VEGFR2 (Tyr1214) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human VEGFR2 around the phosphorylation site of tyrosine 1214 (F-H-YP-D-N).
Modifications Phospho-specific
PIP5K1 alpha (PIP5K1A) Rabbit Polyclonal Antibody
TA343090

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-PIP5K1A Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Pip5k1a antibody is: synthetic peptide directed towards the N-terminal region of Mouse Pip5k1a. Synthetic peptide located within the following region: EGPSASVMPVKKIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLS
RAB11A Goat Polyclonal Antibody
TA302587

USD 520.00

5 Days

Goat Polyclonal Antibody against RAB11A / YL8

Applications WB
Reactivities Mouse (Expected from sequence similarity: Human, Rat, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence TENKPKVQCCQNI, from the C Terminus of the protein sequence according to NP_004654.