Antibodies

View as table Download

Rabbit Polyclonal Anti-NEMF Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human NEMF

Rabbit polyclonal anti-SDCG1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SDCG1.

Rabbit Polyclonal Anti-NEMF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NEMF Antibody is: synthetic peptide directed towards the C-terminal region of Human NEMF. Synthetic peptide located within the following region: YKVKLTPGVQKKGKAAKTALNSFMHSKEATAREKDLFRSVKDTDLSRNIP