Rabbit Polyclonal antibody to TBCK (TBC1 domain containing kinase)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Chicken, Rat, Xenopus, Zebrafish, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 457 and 694 of TBCK (Uniprot ID#Q8TEA7) |
Rabbit Polyclonal Anti-TBCK
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MGC16169 antibody: synthetic peptide directed towards the middle region of human MGC16169. Synthetic peptide located within the following region: PPICTLPNFLFEDGESFGQGRDRSSLLDDTTVTLSLCQLRNRLKDVGGEA |
Germany
Japan
United Kingdom
China
