Rabbit Polyclonal Anti-GABARAPL1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GABARAPL1 Antibody: synthetic peptide directed towards the N terminal of human GABARAPL1. Synthetic peptide located within the following region: MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYL |
Rabbit Polyclonal Anti-GABARAPL1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GABARAPL1 Antibody: synthetic peptide directed towards the middle region of human GABARAPL1. Synthetic peptide located within the following region: KAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTI |
GABARAPL1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of mouse GABARAPL1 |
GABARAPL1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human GABARAPL1 (NP_113600.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
