Antibodies

Jump to Filters
View as table Download
PLA2G2C (C-term) Rabbit Polyclonal Antibody
AP53323PU-N

USD 580.00

2 Weeks

PLA2G2C (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 121-149 amino acids from the C-terminal region of human PLA2G2C
PLA2G2C Rabbit Polyclonal Antibody
TA334348

USD 539.00

5 Days

Rabbit Polyclonal Anti-PLA2G2C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLA2G2C antibody is: synthetic peptide directed towards the middle region of Human PLA2G2C. Synthetic peptide located within the following region: LGDKGIPVDDTDSPSSPSPYEKLKEFSCQPVLNSYQFHIVNGAVVCGCTL