Antibodies

Jump to Filters
View as table Download
SFRS7 (SRSF7) Rabbit Polyclonal Antibody
TA314524

USD 380.00

In Stock

Rabbit polyclonal anti-SFRS7 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SFRS7.
SFRS7 (SRSF7) (N-term) Rabbit Polyclonal Antibody
AP53881PU-N

USD 580.00

2 Weeks

SFRS7 (SRSF7) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 69-98 amino acids from the N-terminal region of Human SFRS7
SFRS7 (SRSF7) Rabbit Polyclonal Antibody
TA336041

USD 539.00

5 Days

Rabbit Polyclonal Anti-SFRS7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SFRS7 Antibody: synthetic peptide directed towards the N terminal of human SFRS7. Synthetic peptide located within the following region: MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFA
SFRS7 (SRSF7) Rabbit Polyclonal Antibody
TA336042

USD 539.00

5 Days

Rabbit Polyclonal Anti-SFRS7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SFRS7 Antibody: synthetic peptide directed towards the middle region of human SFRS7. Synthetic peptide located within the following region: SRSGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSP