Rabbit Polyclonal antibody to RPS3A (ribosomal protein S3A)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 14 and 264 of RPS3A (Uniprot ID#P61247) |
Rabbit Polyclonal Anti-RPS3A Antibody
| Applications | WB |
| Reactivities | Human, Arabidopsis thaliana |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RPS3A Antibody: synthetic peptide directed towards the N terminal of human RPS3A. Synthetic peptide located within the following region: APAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVAFRKF |
Germany
Japan
United Kingdom
China
