Antibodies

Jump to Filters
View as table Download
RPL34 Rabbit Polyclonal Antibody
TA314468

USD 380.00

4 Weeks

Rabbit polyclonal anti-RPL34 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPL34.
RPL34 Rabbit Polyclonal Antibody
TA338353

USD 539.00

5 Days

Rabbit Polyclonal Anti-RPL34 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPL34 antibody is: synthetic peptide directed towards the C-terminal region of Human RPL34. Synthetic peptide located within the following region: SKTKKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVLKAQAQSQKAK