Antibodies

Jump to Filters
View as table Download
HPSE2 (C-term) Rabbit Polyclonal Antibody
AP52095PU-N

USD 580.00

2 Weeks

HPSE2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 450-480 amino acids from the C-terminal region of human Heparanase-2 / HPA2
HPSE2 Rabbit Polyclonal Antibody
TA338291

USD 539.00

5 Days

Rabbit Polyclonal Anti-HPSE2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HPSE2 antibody is: synthetic peptide directed towards the N-terminal region of Human HPSE2. Synthetic peptide located within the following region: SPAFLRFGGKRTDFLQFQNLRNPAKSRGGPGPDYYLKNYEDEPNNYRTMH