Rabbit Polyclonal Anti-ACSL1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACSL1 antibody: synthetic peptide directed towards the C terminal of human ACSL1. Synthetic peptide located within the following region: GSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNG |
Rabbit Polyclonal ACSL1 Antibody
| Applications | ICC/IF, Simple Western, WB |
| Reactivities | Human, Mouse, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an N-terminal portion of the human ACSL1 protein (within residues 1-100). [Swiss-Prot# P33121] |
Rabbit Polyclonal Anti-ACSL1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACSL1 antibody: synthetic peptide directed towards the N terminal of human ACSL1. Synthetic peptide located within the following region: ALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSY |
Rabbit Polyclonal ACSL1 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal ACSL1 antibody was raised against an 18 amino acid peptide near the center of human ACSL1. The immunogen is located within amino acids 240 - 290 of ACSL1. |
Germany
Japan
United Kingdom
China
