Antibodies

Jump to Filters
View as table Download
ACOX3 Rabbit Polyclonal Antibody
TA308019

USD 625.00

2 Weeks

Rabbit Polyclonal antibody to ACOX3 (acyl-Coenzyme A oxidase 3, pristanoyl)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 408 and 603 of ACOX3
ACOX3 Rabbit Polyclonal Antibody
TA343059

USD 539.00

5 Days

Rabbit Polyclonal Anti-ACOX3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ACOX3 antibody: synthetic peptide directed towards the C terminal of human ACOX3. Synthetic peptide located within the following region: SWTTQQGIQECREACGGHGYLAMNRLGVLRDDNDPNCTYEGDNNILLQQT