Rabbit Polyclonal anti-NOTCH4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NOTCH4 |
Rabbit Polyclonal anti-NOTCH4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NOTCH4 |
Rabbit Polyclonal Anti-NOTCH4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NOTCH4 antibody: synthetic peptide directed towards the middle region of human NOTCH4. Synthetic peptide located within the following region: KALKPKAEVDEDGVVMCSGPEEGEEVGQAEETGPPSTCQLWSLSGGCGAL |
Rabbit Polyclonal Anti-NOTCH4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NOTCH4 antibody: synthetic peptide directed towards the C terminal of human NOTCH4. Synthetic peptide located within the following region: CDWVALGACGSASNIPIPPPCLTPSPERGSPQLDCGPPALQEMPINQGGE |
Rabbit Polyclonal anti-NOTCH4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NOTCH4 |
Special Offer: Get this product for $99/€99. Use code: "Truesample".