Rabbit polyclonal antibody to Adenosine Deaminase (adenosine deaminase, RNA-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 472 and 757 of ADAR1 (Uniprot ID#P55265) |
Rabbit Polyclonal Anti-ADAR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADAR antibody: synthetic peptide directed towards the C terminal of human ADAR. Synthetic peptide located within the following region: RMGFTEVTPVTGASLRRTMLLLSRSPEAQPKTLPLTGSTFHDQIAMLSHR |
ADAR mouse monoclonal antibody,clone OTI5G2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-ADAR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADAR antibody: synthetic peptide directed towards the N terminal of human ADAR. Synthetic peptide located within the following region: GEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAVS |
Germany
Japan
United Kingdom
China
