Antibodies

View as table Download

Rabbit Polyclonal Anti-CRLF2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CRLF2

Mouse Polyclonal TSLP R/CRLF2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Amino acids 119-231 of human TSLPR protein were used as the immunogen for the antibody.

Mouse Polyclonal TSLP R/CRLF2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Amino acids 119-231 of human TSLPR protein were used as the immunogen for the antibody.

Mouse Monoclonal TSLP R/CRLF2 Antibody (59N5G4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

CRLF2 mouse monoclonal antibody, clone AT4E7, Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated

CRLF2 mouse monoclonal antibody, clone AT4E7, Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-CRLF2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CRLF2 Antibody: synthetic peptide directed towards the middle region of human CRLF2. Synthetic peptide located within the following region: FWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSKF