Antibodies

Jump to Filters
View as table Download
HARS1 Rabbit Polyclonal Antibody
TA313996

USD 380.00

2 Weeks

Rabbit polyclonal anti-HARS antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human HARS.
HARS1 Rabbit Polyclonal Antibody
TA343149

USD 539.00

5 Days

Rabbit Polyclonal Anti-HARS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HARS antibody: synthetic peptide directed towards the N terminal of human HARS. Synthetic peptide located within the following region: FVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETL