Antibodies

Jump to Filters
View as table Download
Cytokeratin 19 (KRT19) Goat Polyclonal Antibody
TA326740

USD 520.00

5 Days

Goat Anti-cytokeratin 19 (aa285-298) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HTEQLQMSRSEVTD, from the internal region of the protein sequence according to NP_002267.2.
Cytokeratin 19 (KRT19) Goat Polyclonal Antibody
TA326741

USD 520.00

5 Days

Goat Anti-cytokeratin 19 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EGQEDHYNNLSASK, from the C Terminus of the protein sequence according to NP_002267.2.
Cytokeratin 19 (KRT19) Rabbit Polyclonal Antibody
TA346188

USD 539.00

5 Days

Rabbit Polyclonal Anti-KRT19 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-KRT19 antibody is: synthetic peptide directed towards the middle region of Human KRT19. Synthetic peptide located within the following region: DMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLR
Cytokeratin 19 (KRT19) Rabbit Polyclonal Antibody
TA347413

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Keratin 19 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Keratin 19 Antibody: A synthesized peptide derived from human Keratin 19
Cytokeratin 19 (KRT19) Mouse Monoclonal Antibody [Clone ID: OTI3A11]
TA500214S

USD 200.00

2 Days

Anti-CK19 (Keratin 19) mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)

Applications WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".