Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Neurofilament M Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Neurofilament M (NP_005373.2). |
| Modifications | Unmodified |
Phospho-Neurofilament Medium (Ser614/Ser619) Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphopeptide corresponding to residues surrounding Ser614/Ser619 of human 160 kD Neurofilament Medium (Phosphorylated) |
Rabbit Polyclonal Anti-Nefm Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Nefm antibody is: synthetic peptide directed towards the C-terminal region of Rat Nefm. Synthetic peptide located within the following region: GGDGATKYITKSVTVTQKVEEHEETFEEKLVSTKKVEKVTSHAIVKEVTQ |
