Antibodies

Jump to Filters
View as table Download
MRPL13 Rabbit Polyclonal Antibody
TA315390

USD 380.00

In Stock

Rabbit polyclonal anti-MRPL13 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human MRPL13.
MRPL13 (C-term) Rabbit Polyclonal Antibody
AP33215PU-N

USD 535.00

2 Weeks

MRPL13 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide derived from C-terminal region of Human MRPL13.
MRPL13 Rabbit Polyclonal Antibody
TA334495

USD 539.00

5 Days

Rabbit Polyclonal Anti-MRPL13 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MRPL13 antibody: synthetic peptide directed towards the middle region of human MRPL13. Synthetic peptide located within the following region: AIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKNLVEELPQPRKIPKRLD