Antibodies

Jump to Filters
View as table Download
GABA A Receptor alpha 1 (GABRA1) Rabbit Polyclonal Antibody
TA351205

USD 380.00

In Stock

Rabbit Polyclonal Anti-GABRA1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GABRA1
GABA A Receptor alpha 1 (GABRA1) Rabbit Polyclonal Antibody
TA338499

USD 539.00

5 Days

Rabbit Polyclonal Anti-GABRA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRA1 antibody: synthetic peptide directed towards the N terminal of human GABRA1. Synthetic peptide located within the following region: WAWILLLSTLTGRSYGQPSLQDELKDNTTVFTRILDRLLDGYDNRLRPGL
GABA A Receptor alpha 1 (GABRA1) Rabbit Polyclonal Antibody
TA338500

USD 539.00

5 Days

Rabbit Polyclonal Anti-GABRA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRA1 antibody: synthetic peptide directed towards the middle region of human GABRA1. Synthetic peptide located within the following region: YDLLGQTVDSGIVQSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVIL