Antibodies

Jump to Filters
View as table Download
1 AGP acyltransferase 4 (AGPAT4) Rabbit Polyclonal Antibody
TA343074

USD 539.00

5 Days

Rabbit Polyclonal Anti-AGPAT4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AGPAT4 antibody: synthetic peptide directed towards the middle region of human AGPAT4. Synthetic peptide located within the following region: EMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISM
1 AGP acyltransferase 4 (AGPAT4) Rabbit Polyclonal Antibody
TA315628

USD 380.00

4 Weeks

Rabbit polyclonal anti-AGPAT4 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AGPAT4.