Rabbit Polyclonal IL-22 Receptor Antibody
| Applications | IF, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | IL-22 receptor antibody was raised against a synthetic peptide corresponding to amino acids near the amino terminus of human IL-22 receptor precursor . |
Rabbit Polyclonal Anti-IL22RA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL22RA1 antibody: synthetic peptide directed towards the middle region of human IL22RA1. Synthetic peptide located within the following region: YRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQ |
Rabbit Polyclonal Anti-IL22RA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL22RA1 antibody: synthetic peptide directed towards the middle region of human IL22RA1. Synthetic peptide located within the following region: DQGPSPWGLLESLVCPKDEAKSPAPETSDLEQPTELDSLFRGLALTVQWE |
Germany
Japan
United Kingdom
China
