Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-SPAM1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SPAM1 antibody is: synthetic peptide directed towards the C-terminal region of Human SPAM1. Synthetic peptide located within the following region: CYSTLSCKEKADVKDTDAVDVCIADGVCIDAFLKPPMETEEPQIFYNASP |
beta glucuronidase (GUSB) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | FC, IHC, WB |
| Reactivities | Human, Porcine |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 335 - 362 amino acids from the Center region of Human Beta-glucuronidase |
Rabbit Polyclonal Anti-GUSB Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GUSB antibody: synthetic peptide directed towards the C terminal of human GUSB. Synthetic peptide located within the following region: VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPF |
Rabbit polyclonal anti-GUSB antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GUSB. |
Rabbit Polyclonal Anti-HS3ST3B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HS3ST3B1 antibody: synthetic peptide directed towards the N terminal of human HS3ST3B1. Synthetic peptide located within the following region: AMLCVWLYMFLYSCAGSCAAAPGLLLLGSGSRAAHDPPALATAPDGTPPR |
Rabbit Polyclonal Anti-HGSNAT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HGSNAT antibody is: synthetic peptide directed towards the C-terminal region of Human HGSNAT. Synthetic peptide located within the following region: VKGLWTGTPFFYPGMNSILVYVGHEVFENYFPFQWKLKDNQSHKEHLTQN |
GNS rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human GNS |
GNS rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human GNS |
Rabbit Polyclonal Anti-HGSNAT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HGSNAT antibody is: synthetic peptide directed towards the N-terminal region of Human HGSNAT. Synthetic peptide located within the following region: RALAALLLAASVLSAALLAPGGSSGRDAQAAPPRDLDKKRHAELKMDQAL |
HGSNAT Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HGSNAT |
Active filters
Category
- Antibodies
Reactivities
- Human
Applications
- WB
Families
- Transmembrane
Pathways
- Glycosaminoglycan degradation