Germany
Japan
United Kingdom
China
USD 509.00
2 Weeks
IFNLR1 mouse monoclonal antibody,clone OTI3D5, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
Antibodies
View as table Download
USD 509.00
2 Weeks
IFNLR1 mouse monoclonal antibody,clone OTI1B1, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 509.00
2 Weeks
IFNLR1 mouse monoclonal antibody,clone OTI1B1, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
USD 509.00
2 Weeks
IFNLR1 mouse monoclonal antibody,clone OTI7B2, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 509.00
2 Weeks
IFNLR1 mouse monoclonal antibody,clone OTI7B2, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
USD 200.00
In Stock
IFNLR1 mouse monoclonal antibody,clone OTI3F5
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 200.00
In Stock
IFNLR1 mouse monoclonal antibody,clone OTI8G1
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-IL28RA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL28RA antibody: synthetic peptide directed towards the N terminal of human IL28RA. Synthetic peptide located within the following region: EECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLF |
Rabbit Polyclonal Anti-IL28RA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL28RA antibody: synthetic peptide directed towards the N terminal of human IL28RA. Synthetic peptide located within the following region: QDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRV |
USD 200.00
2 Days
IFNLR1 mouse monoclonal antibody,clone OTI3D5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 200.00
2 Days
IFNLR1 mouse monoclonal antibody,clone OTI1B1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 200.00
2 Days
IFNLR1 mouse monoclonal antibody,clone OTI7B2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- IL28 RECEPTOR ALPHA
Applications
- WB
Families
- Transmembrane
Pathways
- Jak-STAT signaling pathway