Antibodies

Jump to Filters
View as table Download
ETS1 associated protein II (TDP2) Rabbit Polyclonal Antibody
TA351171

USD 380.00

In Stock

Rabbit Polyclonal Anti-TDP2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human TDP2
ETS1 associated protein II (TDP2) Rabbit Polyclonal Antibody
TA324392

USD 580.00

5 Days

Rabbit polyclonal EAPII Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This EAPII antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 246-272 amino acids from the C-terminal region of human EAPII.
ETS1 associated protein II (TDP2) Rabbit Polyclonal Antibody
TA331907

USD 539.00

5 Days

Rabbit Polyclonal Anti-TTRAP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TTRAP Antibody: synthetic peptide directed towards the middle region of human TTRAP. Synthetic peptide located within the following region: IPPYYSYLKKRSSNYEIITGHEEGYFTAIMLKKSRVKLKSQEIIPFPSTK
ETS1 associated protein II (TDP2) Mouse Monoclonal Antibody [Clone ID: OTI3G10]
TA811981S

USD 200.00

In Stock

TDP2 mouse monoclonal antibody,clone OTI3G10

Applications WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ETS1 associated protein II (TDP2) Rabbit Polyclonal Antibody
TA309898

USD 845.00

In Stock

Rabbit Polyclonal ETS1 associated protein II Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to residues 11-28 (REAAEEEGEPEVKKRRLL) of human EAPII.