Antibodies

View as table Download

Rabbit polyclonal anti-ERCC5 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ERCC5.

Rabbit Polyclonal Anti-ERCC5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ERCC5 Antibody: synthetic peptide directed towards the N terminal of human ERCC5. Synthetic peptide located within the following region: NPQAIDIESEDFSSLPPEVKHEILTDMKEFTKRRRTLFEAMPEESDDFSQ

Rabbit Polyclonal Anti-ERCC5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ERCC5 Antibody is: synthetic peptide directed towards the N-terminal region of Human ERCC5. Synthetic peptide located within the following region: HSGHIRRQYEDEGGFLKEVESRRVVSEDTSHYILIKGIQAKTVAEVDSES