Antibodies

View as table Download

BMP6 mouse monoclonal antibody,clone OTI8B11, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

BMP6 mouse monoclonal antibody,clone OTI6G9, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

BMP6 mouse monoclonal antibody,clone OTI6G9, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Rabbit Polyclonal Anti-BMP6 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BMP6 antibody: synthetic peptide directed towards the N terminal of human BMP6. Synthetic peptide located within the following region: DGGSPGRTEQPPPSPQSSSGFLYRRLKTQEKREMQKEILSVLGLPHRPRP

Rabbit Polyclonal Anti-BMP6 Antibody - middle region

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-BMP6 antibody: synthetic peptide directed towards the middle region of human BMP6. Synthetic peptide located within the following region: MVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSEL