Antibodies

View as table Download

Rabbit Polyclonal Anti-STK17A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human STK17A

Rabbit Polyclonal DRAK1 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DRAK1 antibody was raised against a peptide corresponding to amino acids near the amino terminus of human DRAK1.

Rabbit polyclonal antibody to DRAK1 (serine/threonine kinase 17a)

Applications IHC, WB
Reactivities Human (Predicted: Rabbit, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 231 of DRAK1 (Uniprot ID#Q9UEE5)

Rabbit Polyclonal Anti-STK17A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STK17A antibody: synthetic peptide directed towards the C terminal of human STK17A. Synthetic peptide located within the following region: KESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQEIPGE

Rabbit Polyclonal Anti-STK17A Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-STK17A antibody is: synthetic peptide directed towards the C-terminal region of Human STK17A. Synthetic peptide located within the following region: KSETKESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQE