Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal MMP23 (Cleaved-Tyr79) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human MMP23. |
MMP23 (MMP23B) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | MMP23B antibody was raised against a synthetic peptide derived from C-terminus of human MMP-23 protein |
Rabbit Polyclonal Anti-MMP23B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MMP23B antibody: synthetic peptide directed towards the middle region of human MMP23B. Synthetic peptide located within the following region: QKILHKKGKVYWYKDQEPLEFSYPGYLALGEAHLSIIANAVNEGTYTCVV |
Rabbit Polyclonal Anti-MMP23B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MMP23B antibody: synthetic peptide directed towards the N terminal of human MMP23B. Synthetic peptide located within the following region: ILSFPRNLLSPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYP |
Rabbit Polyclonal Anti-MMP23 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MMP23 Antibody: A synthesized peptide derived from human MMP23 |
Active filters
Category
- Antibodies
Target Symbol
- MMP23
Applications
- WB
Isotypes
- IgG
Families
- Protease