Rabbit Polyclonal Anti-CTRL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTRL antibody: synthetic peptide directed towards the N terminal of human CTRL. Synthetic peptide located within the following region: LLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSL |
Rabbit Polyclonal anti-CTRL Antibody
| Applications | WB |
| Reactivities | Human, Rat, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CTRL |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-CTRL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTRL antibody: synthetic peptide directed towards the N terminal of human CTRL. Synthetic peptide located within the following region: SQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNS |
Germany
Japan
United Kingdom
China
