Germany
Japan
United Kingdom
China
CDC25B mouse monoclonal antibody,clone OTI6H9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Antibodies
View as table Download
CDC25B mouse monoclonal antibody,clone OTI11C5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CDC25B mouse monoclonal antibody,clone OTI11C5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CDC25B mouse monoclonal antibody,clone OTI6H9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 509.00
2 Weeks
CDC25B mouse monoclonal antibody,clone OTI11C5, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
CDC25B mouse monoclonal antibody,clone OTI11C5, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
USD 509.00
2 Weeks
CDC25B mouse monoclonal antibody,clone OTI6H9, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
CDC25B mouse monoclonal antibody,clone OTI6H9, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
Rabbit polyclonal CDC25A (Ab-178) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CDC25A around the phosphorylation site of serine 178 (Q-N-SP-A-P). |
Rabbit Polyclonal Anti-CDC25B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: TQTMHDLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSE |
CDC25B mouse monoclonal antibody,clone OTI6H9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal CDC25A (Ser75) antibody(Phospho-specific)
| Applications | IHC, WB |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CDC25A around the phosphorylation site of Ser75 |
| Modifications | Phospho-specific |
Rabbit polyclonal CDC25A (Ser178) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CDC25A around the phosphorylation site of serine 178 (Q-N-SP-A-P). |
| Modifications | Phospho-specific |
Rabbit Polyclonal CDC25A (Ser75) Antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human CDC25A around the phosphorylation site of Sersine 75. |
| Modifications | Phospho-specific |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- WB
Families
- Phosphatase
Pathways
- Progesterone-mediated oocyte maturation