Antibodies

View as table Download

Rabbit polyclonal Retinoid X Receptor gamma antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Retinoid X Receptor ? antibody.

Retinoid X Receptor gamma (RXRG) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 150-250 of Human RXRγ.

Goat Polyclonal Antibody against RXR gamma

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence RQRSRERAESEAEC, from the internal region of the protein sequence according to NP_008848.

Rabbit Polyclonal Anti-RXRG Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRG antibody: synthetic peptide directed towards the C terminal of human RXRG. Synthetic peptide located within the following region: LEAYTKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDT