Antibodies

Jump to Filters
View as table Download
KCNH8 Rabbit Polyclonal Antibody
TA338733

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-Kcnh8 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Kcnh8 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LVGSSPQRTEAHEQNPADSELHHSPNLDYSPSHCQVIQEGHLQFLRCISP
KCNH8 Rabbit Polyclonal Antibody
TA355768

USD 539.00

5 Days

KCNH8 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of human KCNH8