Antibodies

Jump to Filters
View as table Download
CACNG1 Rabbit Polyclonal Antibody
TA313541

USD 380.00

4 Weeks

Rabbit polyclonal anti-CACNG1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CACNG1.
CACNG1 Rabbit Polyclonal Antibody
TA344183

USD 539.00

5 Days

Rabbit Polyclonal Anti-CACNG1 Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Cacng1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AVHNKDKSCEHVTPSGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAI