Antibodies

Jump to Filters
View as table Download
CACNA1C Goat Polyclonal Antibody
TA305878

USD 520.00

In Stock

Goat Anti-CACNA1C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RARGRPSEEELQD, from the C Terminus of the protein sequence according to NP_000710.5.
CACNA1S Rabbit Polyclonal Antibody
TA308209

USD 625.00

5 Days

Rabbit polyclonal antibody to CACNA1S (calcium channel, voltage-dependent, L type, alpha 1S subunit)

Applications IHC, WB
Reactivities Human (Predicted: Mouse, Feline, Rabbit, Rat)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 544 and 885 of CACNA1S (Uniprot ID#Q13698)
CACNA1C Rabbit Polyclonal Antibody
TA328700

USD 850.00

3 Weeks

Rabbit Polyclonal Anti-human CaV1.2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide VNENTRMYIPEENHQ(C), corresponding to amino acid residues 2-15 of human Cav1.2 (exon 1B). Intracellular, N-terminus.
CACNA1I Rabbit Polyclonal Antibody
TA338596

USD 539.00

5 Days

Rabbit Polyclonal Anti-CACNA1I Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNA1I antibody: synthetic peptide directed towards the middle region of human CACNA1I. Synthetic peptide located within the following region: LRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWAS
CACNA1H Rabbit Polyclonal Antibody
TA314833

USD 380.00

4 Weeks

Rabbit polyclonal anti-CACNA1H antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CACNA1H.
CACNA1G Mouse Monoclonal Antibody [Clone ID: S178A-9]
TA326469

USD 570.00

2 Weeks

Mouse Monoclonal Anti-CaV3.1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated