Antibodies

Jump to Filters
View as table Download
GPR142 Rabbit Polyclonal Antibody
TA316387

USD 380.00

In Stock

Rabbit polyclonal anti-GPR142 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GPR142.
GPR142 Goat Polyclonal Antibody
TA305852

USD 520.00

5 Days

Goat Anti-GPR142 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DMWRDTDSPRTLD, from the internal region of the protein sequence according to NP_861455.1.
GPR142 Rabbit Polyclonal Antibody
TA331328

USD 539.00

5 Days

Rabbit Polyclonal Anti-GPR142 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GPR142 antibody is: synthetic peptide directed towards the N-terminal region of Human GPR142. Synthetic peptide located within the following region: IMMLPMEQKIQWVPTSLQDITAVLGTEAYTEEDKSMVSHAQKSQHSCLSH