Germany
Japan
United Kingdom
China
Antibodies
View as table Download
USD 509.00
2 Weeks
Rabbit polyclonal IGFBP2 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Predicted: Bovine, Pig) |
| Conjugation | Unconjugated |
| Immunogen | This IGFBP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 277-305 amino acids from the C-terminal region of human IGFBP2. |
IGFBP2 mouse monoclonal antibody, clone OTI1A7 (formerly 1A7)
| Applications | FC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal anti-IBP2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human IGFBP2. |
Rabbit Polyclonal Anti-IGFBP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IGFBP2 Antibody: synthetic peptide directed towards the middle region of human IGFBP2. Synthetic peptide located within the following region: KPLKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQ |
Rabbit Polyclonal Anti-IGFBP2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IGFBP2 Antibody: synthetic peptide directed towards the middle region of human IGFBP2. Synthetic peptide located within the following region: LEEPKKLRPPPARTPCQQELDQVLERISTMRLPDERGPLEHLYSLHIPNC |
Active filters
Category
- Antibodies
Target Symbol
- IGFBP2
Applications
- WB
Families
- Embryonic stem cells