Antibodies

View as table Download

Goat Polyclonal Antibody against DKK1

Applications FC, IF, IHC, PEP-ELISA, WB
Reactivities Human (Expected from sequence similarity: Rat, Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence CDHHQASNSSRLHT, from the C Terminus of the protein sequence according to NP_036374.

Rabbit Polyclonal Anti-DKK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DKK1 antibody: synthetic peptide directed towards the C terminal of human DKK1. Synthetic peptide located within the following region: CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD

Rabbit Polyclonal Anti-DKK1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DKK1 antibody is: synthetic peptide directed towards the C-terminal region of Human DKK1. Synthetic peptide located within the following region: CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD

DKK1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 64~93 amino acids from the N-terminal region of Human Dickkopf-1.