Anti-MAPK11 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-MAPK11 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAPK11 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
In Stock
Anti-MAPK11 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2), Biotinylated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Anti-MAPK11 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2), HRP conjugated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-MAPK11 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal Anti-Mapk11 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Mapk11 antibody is: synthetic peptide directed towards the N-terminal region of Rat Mapk11. Synthetic peptide located within the following region: VPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTY |