HADHA mouse monoclonal antibody,clone OTI7B3
Applications | WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
HADHA mouse monoclonal antibody,clone OTI7B3
Applications | WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HADHA mouse monoclonal antibody,clone OTI7B3
Applications | WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
HADHA mouse monoclonal antibody,clone OTI7B3, Biotinylated
Applications | WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Biotin |
HADHA mouse monoclonal antibody,clone OTI7B3, HRP conjugated
Applications | WB |
Reactivities | Human, Rat, Mouse |
Conjugation | HRP |
Rabbit Polyclonal Anti-HSD17B12 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HSD17B12 |
HADHA mouse monoclonal antibody,clone OTI7B3
Applications | WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit anti-HADHA Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HADHA |
Rabbit Polyclonal Anti-Hsd17b12 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Hsd17b12 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hsd17b12. Synthetic peptide located within the following region: SAETFVKSAIKTVGLQTRTTGYVIHSLMGSINSIMPRWMYFKIIMGFSKS |