Germany
Japan
United Kingdom
China
Rat monoclonal anti-MIP-3a antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit Polyclonal anti-Ccl20 antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ccl20 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: CCLTYTKNVYHHARNFVGFTTQMADEACDINAIIFHLKSKRSVCADPKQI |
USD 310.00
2 Weeks
Macrophage Inflammatory Protein 3 alpha (CCL20) mouse monoclonal antibody, Azide Free
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal MIP 3 alpha antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant mouse MIP-3a protein. |
USD 285.00
5 Days
MIP-3 alpha Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MIP-3 alpha Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
USD 345.00
2 Weeks
Macrophage Inflammatory Protein 3 alpha (CCL20) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Highly pure (>98%) recombinant human Macrophage Inflammatory Protein 3 alpha (hMIP-3 alpha). |
USD 465.00
2 Weeks
Macrophage Inflammatory Protein 3 alpha (CCL20) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Highly pure (>98%) recombinant human Macrophage Inflammatory Protein 3 alpha (hMIP-3 alpha). |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- CCL20
Applications
- WB
Conjugates
- Unconjugated