Antibodies

View as table Download

Rabbit Polyclonal Anti-CLDN18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN18 antibody: synthetic peptide directed towards the middle region of human CLDN18. Synthetic peptide located within the following region: LVTNFWMSTANMYTGMGGMVQTVQTRYTFGAALFVGWVAGGLTLIGGVMM

Rabbit Polyclonal Anti-CLDN18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN18 antibody: synthetic peptide directed towards the C terminal of human CLDN18. Synthetic peptide located within the following region: PEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDE

Rabbit Polyclonal Anti-CLDN18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CLDN18 Antibody: synthetic peptide directed towards the middle region of human CLDN18. Synthetic peptide located within the following region: YHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDY