Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-H-NUC antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human H-NUC. |
CDC27 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 360-410 of Human Cdc27. |
Rabbit polyclonal CDC27 phospho T244 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding aa 239-249 of Human CDC27. |
Rabbit Polyclonal Anti-CDC27 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CDC27 Antibody: synthetic peptide directed towards the middle region of human CDC27. Synthetic peptide located within the following region: KLKMKFPPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKIST |
Rabbit Polyclonal Anti-CDC27 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC27 antibody is: synthetic peptide directed towards the C-terminal region of Human CDC27. Synthetic peptide located within the following region: SYIDSAVISPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSF |
CDC27 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CDC27 |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- CDC27
Applications
- WB
Conjugates
- Unconjugated
Pathways
- Progesterone-mediated oocyte maturation