Rabbit Polyclonal Anti-PDE1C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PDE1C Antibody: synthetic peptide directed towards the N terminal of human PDE1C. Synthetic peptide located within the following region: DLKKNIEYAASVLEAVYIDETRRLLDTEDELSDIQTDSVPSEVRDWLAST |
Rabbit polyclonal Anti-PDE1C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDE1C antibody: synthetic peptide directed towards the middle region of human PDE1C. Synthetic peptide located within the following region: IDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKR |
Germany
Japan
United Kingdom
China